PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.T6ICI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 286aa    MW: 32805.2 Da    PI: 8.03
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.T6ICIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-54111361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+v+yL++++++k++++ ++i+evdiyk++Pw+Lp k++ +ekewyfFs+r++ky++g r+nrat sgyWkatg+dk+++s k +
  Araip.T6ICI  11 LPPGFRFHPTDEELIVYYLCNQATSKPCPA-SIIPEVDIYKFDPWELPGKAEFGEKEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYS-KCK 106
                  79****************************.89***************99999*****************************************.778 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kk Lvfy+gr pkg ktdW+mheyrl
  Araip.T6ICI 107 HVGVKKALVFYRGRPPKGIKTDWIMHEYRL 136
                  9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-659163IPR003441NAC domain
PROSITE profilePS5100559.51311163IPR003441NAC domain
PfamPF023651.3E-2612136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MEGSSKSCEL LPPGFRFHPT DEELIVYYLC NQATSKPCPA SIIPEVDIYK FDPWELPGKA  60
EFGEKEWYFF SPRERKYPNG VRPNRATVSG YWKATGTDKA IYSKCKHVGV KKALVFYRGR  120
PPKGIKTDWI MHEYRLLQQS NHNSRITGSM RLDDCVLCRI YKKKHAAKAL DQGQEYPTTV  180
QINLNASTNN DDEKELMMMK NLPRTCSLTY LLDMNYFGPI SQLLSDGSYN NSSTFEIFQH  240
SNSVDNIGIV DPLVKTQMVE MDDSYYAQDS GKSQVMKQGN DLRGYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-731116820173NAC domain-containing protein 19
3swp_C5e-731116820173NAC domain-containing protein 19
3swp_B5e-731116820173NAC domain-containing protein 19
3swp_A5e-731116820173NAC domain-containing protein 19
3swm_D5e-731116820173NAC domain-containing protein 19
3swm_C5e-731116820173NAC domain-containing protein 19
3swm_B5e-731116820173NAC domain-containing protein 19
3swm_A5e-731116820173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016190915.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-108NAC29_ARATH; NAC transcription factor 29
TrEMBLD0PWB21e-134D0PWB2_CICAR; NAC family transcription factor 3
STRINGGLYMA02G12220.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-110NAC-like, activated by AP3/PI